PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN15643.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 313aa    MW: 35712.7 Da    PI: 6.6212
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN15643.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.65.7e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+d ++++G  +W++ ++  g++R++k+c++rw +yl
       KHN15643.1 14 KGPWTPEEDQKLIDHIQKYGHASWRALPKLAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding56.94.8e-1867112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE++ ++d+++ lG++ W++Ia++++ gRt++++k++w+++l
       KHN15643.1  67 RGKFSQEEEQTILDLHAVLGNK-WSAIASHLP-GRTDNEIKNFWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-25564IPR009057Homeodomain-like
PROSITE profilePS5129417.115961IPR017930Myb domain
SuperFamilySSF466891.5E-3111108IPR009057Homeodomain-like
SMARTSM007175.8E-151363IPR001005SANT/Myb domain
PfamPF002491.2E-161461IPR001005SANT/Myb domain
CDDcd001672.93E-111661No hitNo description
PROSITE profilePS5129426.99662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.6E-2865117IPR009057Homeodomain-like
SMARTSM007174.6E-1766114IPR001005SANT/Myb domain
PfamPF002491.2E-1667112IPR001005SANT/Myb domain
CDDcd001675.90E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MGRSPCCDEI GLKKGPWTPE EDQKLIDHIQ KYGHASWRAL PKLAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF SQEEEQTILD LHAVLGNKWS AIASHLPGRT DNEIKNFWNT HLKKKLIQMG  120
YDPMTHQPRI DDIFTGLSHL IALANLKEHL DHLHQHQPWE QNLARLQELA RLQCLQQHLL  180
LLQASLTDAD PNTIDSIINS TFMNKDTINV SNDQFENIIM SSNGTMPFYH MPELKTHPCS  240
YEAPISNKDM VQFSRGESYP NSPWLLSCSS TIPSSPSSLV APPVTEISLT NVEDNCTIWP  300
ELLLEDPLFK MIS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-31121165108B-MYB
1h8a_C2e-311211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150432e-65AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006573182.10.0PREDICTED: transcription factor MYB39-like
TrEMBLA0A0B2Q6G70.0A0A0B2Q6G7_GLYSO; Transcription factor MYB39
TrEMBLI1J6720.0I1J672_SOYBN; Uncharacterized protein
STRINGGLYMA01G09280.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10280.15e-91myb domain protein 92
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]